PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C014042P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 97aa    MW: 10603 Da    PI: 4.3765
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C014042P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like27.37.9e-094070232
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPkti 32
                      l+W  eLHer+v+av+qL G+++   kt 
  MELO3C014042P1 40 SHLHWMVELHERYVDAVTQLDGPDREKDKTT 70
                    6799********************9777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-63769IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MYSAIPALPM DDGGGKFQGS LDGTNLLDDA CLVLTSDLKS HLHWMVELHE RYVDAVTQLD  60
GPDREKDKTT SEIQMAHNFS LPPLSPTGTI FYPNII*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818601e-102LN681860.1 Cucumis melo genomic scaffold, anchoredscaffold00021.
GenBankLN7132601e-102LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008448973.11e-52PREDICTED: uncharacterized protein LOC103490983 isoform X2
TrEMBLA0A0A0L4354e-28A0A0A0L435_CUCSA; Uncharacterized protein
STRINGAT3G24120.21e-21(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15413911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.12e-25G2-like family protein